[PDF] pipelines free ebooks download

View results: Search for a phrase:
ISBN Language MD5 Extension

Library Search

 Fiction Pdf Search   Sci-hubs

113 books found   ►also search"pipelines" in ,
ID Author(s) Title Publisher Year Pages Language Size Extension GET
816129 Michael Peel A Swamp Full of Dollars: Pipelines and Paramilitaries at Nigeria's Oil Frontier
1569762864, 9781569762868
Lawrence Hill Books 2010 241 English 2 Mb pdf GET
1487918 Mohammad Najafi, editor, Baosong Ma Advances and experiences with pipelines and trenchless technology for water, sewer, gas, and oil applications : proceedings of the International Conference on Pipelines and Trenchless Technology 2009, October 18-21, 2009, Shanghai, China [Cdr ed.]
978-0-7844-1073-8, 0784410739, 9780784473177, 078447317X
American Society of Civil Engineers 2009 2137 English 40 Mb pdf GET
1708106 Cordell, J.; Vanzant, H. Hershel All about pigging: The design of pipelines and facilities for conventional and intelligent pigging and a guide to pig selection, operation and maintenance and to pipeline pigging services
On-Stream Systems Ltd 1995 284 English 12 Mb pdf GET
737375 American Petroleum Institute API 2N Recommended Practice for Planning, Designing, and Constructing Structures and Pipelines for Arctic Conditions [Fourth ed.] American Petroleum Institute 1996 21 English 6 Mb pdf GET
617638 API API RP 1111 4th Ed. Dec. 2009 - Design, Construction, Operation, and Maintenance of Offshore Hydrocarbon Pipelines 79 English 8 Mb pdf GET
1194682 API Standard 1104. Welding of Pipelines and Related Facilities. 21-th edition [21-th ed.] 2013 128 English 1 Mb pdf GET
1444534 American Water Works Association AWWA C209-13 Cold-Applied Tape Coatings for the Exterior of Special Sections, Connections, and Fittings for Steel Water Pipelines
978-1-58321-943-0, 1-58321-943-9, 978-1-61300-232-2, 1-61300-232-7
American Water Works Association 2012 28 English 667 kb pdf GET
1196320 American Water Works Association.; American National Standards Institute AWWA C203
AWWA standard for coal-tar protective coatings and linings for steel water pipelines, enamel and tape, hot applied
American Water Works Association 1992 ix, 39 p. English 3 Mb pdf GET
1196324 American National Standards Institute.; American Water Works Association AWWA C209
AWWA standard for cold-applied tape coatings for the exterior of special sections, connections, and fittings for steel water pipelines
American Water Works Association 1991 vii, 13 p. English 437 kb pdf GET
1196326 American National Standards Institute.; American Water Works Association AWWA C215
AWWA standard for extruded polyolefin coatings for the exterior of steel water pipelines [Rev ed.]
American Water Works Association 1994 viii, 13 p. : ill. English 1 Mb pdf GET
1196325 American National Standards Institute.; American Water Works Association AWWA C213
AWWA standard for fusion-bonded epoxy coating for the interior and exterior of steel water pipelines
American Water Works Association 1985 vi, 12 p. English 1 Mb pdf GET
1196327 American National Standards Institute.; American Water Works Association AWWA C216
AWWA standard for heat-shrinkable cross-linked polyolefin coatings for the exterior of special sections, connections, and fittings for steel water pipelines [1st ed]
American Water Works Association 1989 viii, 10 p. English 359 kb pdf GET
1196330 American Water Works Association.; American National Standards Institute AWWA C225
AWWA standard [for] fused polyolefin coating systems for the exterior of steel water pipelines [Rev ed.]
American Water Works Association 2008 x, 17 p. English 425 kb pdf GET
1440863 Alexander N. Papusha Beam Theory for Subsea Pipelines: Analysis and Practical Applications [1 ed.]
978-1-119-11756-8, 1119117569
Wiley-Scrivener 2015 320 English 11 Mb pdf GET
520127 Margarita M Balmaceda, Kevin Rosner Belarus: Oil, Gas, Transit Pipelines and Russian Foreign Energy Policy
1905050348, 9781905050345, 9781905050833
2006 56 English 2 Mb pdf GET
250184 James Freeman Steffe Bioprocessing Pipelines: Rheology and Analysis
0963203622, 9780963203625
Freeman Press 2006 173 English 2 Mb pdf GET
797117 Hongxun Liu, Zhu Huo, Guozhong Cao (auth.), Denis Cavallucci, Roland de Guio, Gaetano Cascini (eds.) IFIP Advances in Information and Communication Technology 355
Building Innovation Pipelines through Computer-Aided Innovation: 4th IFIP WG 5.4 Working Conference, CAI 2011, Strasbourg, France, June 30 – July 1, 2011. Proceedings [1 ed.]
3642221815, 9783642221811
Springer-Verlag Berlin Heidelberg 2011 194 English 8 Mb pdf GET
1642284 CIRIA CIRIA Guide To The Design Of Thrust Blocks For Buried Pressure Pipelines 1994 101 EN 987 kb pdf GET
1114719 John S. Page Estimator's Man-Hour Library
Cost Estimating Manual for Pipelines and Marine Structures [1 ed.]
0872011577, 9780872011571
Gulf Professional Publishing 1977 336 English 20 Mb pdf GET
654598 John S. Page Cost Estimating Manual for Pipelines and Marine Structures (Estimator's Man-Hour Library)
0872011577, 9780872011571
Gulf Professional Publishing 1977 340 English 20 Mb pdf GET
1110155 Wes McDermott (Auth.) Creating 3D Game Art for the i: Phone with Unity. Featuring modo and Blender pipelines [1 ed.]
Focal Press 2011 261 English 51 Mb pdf GET
402340 Wes McDermott Creating 3D Game Art for the iPhone with Unity: Featuring modo and Blender pipelines
Focal Press 2010 273 English 24 Mb pdf GET
527545 Wes McDermott Creating 3D Game Art for the iPhone with Unity: Featuring modo and Blender pipelines
Focal Press 2010 273 English 24 Mb pdf GET
703711 Wes Mcdermott Creating 3D Game Art for the IPhone With Unity: Featuring Modo and Blender Pipelines
Elsevier 2011 263 English 41 Mb pdf GET
1318266 Ekpen James Omonbude Cross-border Oil and Gas Pipelines and the Role of the Transit Country: Economics, Challenges and Solutions
1137274514, 9781137274519
Palgrave Pivot 2012 150 English 2 Mb pdf GET

If no results, Please search pipelines here Again

Random Recommend
 Haruki Murakami
Esther Vilar
Esther Vilar
Jean-Paul Delahaye
Esther Vilar
Broch Hermann
Christopher Finch
Makridakis S., Wheelwright S.S., McGee V.E.
Witold Lukaszewicz
Witold Lukaszewicz
Jaromir Myslivecek, Jan Jakubik
Sophie Fuggle
Vítor Westhelle
Tomasz Kamusella
Paolo Legrenzi
Robert Weissert
Fulde, Gordian W. O.; Fulde, Sascha
Filippo Osella, Caroline Osella
Denise Kiernan
Burton F. Beers
Amanda S. Coutts, Louise Weston
Manfred Berg, Geoffrey Cocks
John Grieve Smith
Mona AlMunajjed
John Dunstan
Simon Haines
John Mills
Rodney Wilson
Ataullah Siddiqui
Jean-Paul Delahaye
William M. Fowler
Brian K. Alldredge, Robin L. Corelli, Michael E. Ernst, B. Joseph Guglielmo Jr.
Neil Nehring
Robert Sklar
David E. Barclay, Elisabeth Glaser-Schmidt
Paul Moeyes
Jennifer Trusted
J. Kellenberg
Philip Arestis
Sue Onslow
Mark Drakeford
John C. Hulsman
Shemaryahu Taimon
Dominic Rainsford
Jennifer Clapp
Shemaryahu Talmon
Neil Roberts
Christoph Levin
Candace Clark
Noel McGinn, Fernando Reimers
 Афанасьева-Медведева Г.В.
Левина А.
Дербенцева А.М.

Дербенцева А.М.

Ивлев А.М., Дербенцева А.М.
Оглоблин А.Н.
Ивлев А.М., Дербенцева А.М., Старожилов В.Т.

Киселева Г.А.
Булатов В.И., Ткачева Б.П. (ред.)
Подольский В.В.
Шиян Г.М.
Ampton Pete.
Ярков В.В.
Киселева Г.А.

Лень В.С., Нехай В.А.
Келим Ю.М.

Борель Э.
Smit D.D.

Смирнова А.Я., Бабкина О.А.
Оглоблин А.Н.

Большаков В.Д, Левчук Г.П, Багратуни Г.В и др.
Иллич И.
Иванов И.И.
Померанц Л.И.

Блонштейн Е.А., Линчевский Э.Э., Симонов Р.А.
Цаппаса Иоанниса Андреа.
Пурышава Н.М.
Козырева Л.М.

Врублевская Галина.

software engineeringiposlidarginzburg landau theorystatistical analysisinternational relationsrefractive indexbody temperatureethanoltest reliabilityarchitecturex ray diffractionrate limitingamino acid sequencecyclin dependent kinase 4ion beamtaxation lawyoung adultsbiometeorologycellprototypesconducting polymersectionsconvergenceembedmenthomotopy groupbearing capacityceramicsreflectivitycross validationself perceptioncorporate lawdemocracyinfectious diseaseneuroinflammationvarietyhydroxyapatitetrainsshear zonemanagementvocal tractagency theorydielectric constantvolatilizationelectric powercommunicationoscillationsiq scoresstressvectors